GENSCANW output for sequence 11:41:49




GENSCAN 1.0	Date run: 24-Feb-102	Time: 11:42:41

Sequence AC091491 : 152882 bp : 38.35% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:


Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +   8335   8462  128  2  2   88   45   112 0.427   4.36
 1.02 PlyA +   8915   8920    6                               1.05

 2.11 PlyA -   9099   9094    6                               1.05
 2.10 Term -   9458   9279  180  2  0   85   55   213 0.996  14.33
 2.09 Intr -  19259  19056  204  2  0   31   67   103 0.205   0.97
 2.08 Intr -  31235  31126  110  0  2   91   65    52 0.009   2.28
 2.07 Intr -  34701  34598  104  2  2   49  100    17 0.002  -2.10
 2.06 Intr -  53767  53686   82  2  1   68  102    50 0.823   2.18
 2.05 Intr -  56317  56242   76  1  1  106  111    67 0.954   8.97
 2.04 Intr -  61689  61582  108  0  0   79   31    89 0.704   1.86
 2.03 Intr -  84483  84280  204  0  0   69  101   212 0.877  19.07
 2.02 Intr -  89517  87031 2487  0  0  111   96  1876 0.952 177.08
 2.01 Init - 104263 104213   51  1  0   34   93    49 0.208   1.21
 2.00 Prom - 111210 111171   40                              -3.65


Click here to view a PDF image of the predicted gene(s)

Click here for a PostScript image of the predicted gene(s)


Predicted peptide sequence(s):


>AC091491|GENSCAN_predicted_peptide_1|42_aa
XSEVHITTDLIQKHQEGSCGYLGSLYSQLLLLKAVETLPKAK

>AC091491|GENSCAN_predicted_peptide_2|1201_aa
MEEARAEIGESELECPKDGTKQKRERKKTVSFSSMPTEKKISSASDCINSMVEGSELKKV
RSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQI
SEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLISYGKHTLDMLESSQDNMRTSWV
SQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFI
EVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSK
EGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRG
PSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASE
YPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDVLKGKILIKAKKL
SSNCSGVEGDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQFKE
FQVSFQVQKYWEVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDF
WKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVS
PQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFD
ESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHA
SLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATD
LRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGI
VPEVLKKIVTTYDMQLKDFSDFVTSLETATTEDAVATSVLSRTGKESSLEMIQSLKALIE
NADAVYEKIVHCQKAGTCYADVSTGKRKRGRRGMLRSEDLQPSVCEVPGKLPCDSLGCVS
FVLALALACHRETVKSQAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKKHLFGS
SKNQGQELCLEGSPFRSCTEPFIPLWQLLCTLWGGGQGGGKAVFLLWGDKLICSSCSMPI
KRGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETG
E


Explanation

Gn.Ex : gene number, exon number (for reference)
Type  : Init = Initial exon (ATG to 5' splice site)
        Intr = Internal exon (3' splice site to 5' splice site)
        Term = Terminal exon (3' splice site to stop codon)
        Sngl = Single-exon gene (ATG to stop)
        Prom = Promoter (TATA box / initation site)
        PlyA = poly-A signal (consensus: AATAAA)
S     : DNA strand (+ = input strand; - = opposite strand)
Begin : beginning of exon or signal (numbered on input strand)
End   : end point of exon or signal (numbered on input strand)
Len   : length of exon or signal (bp)
Fr    : reading frame (a forward strand codon ending at x has frame x mod 3)
Ph    : net phase of exon (exon length modulo 3)
I/Ac  : initiation signal or 3' splice site score (tenth bit units)
Do/T  : 5' splice site or termination signal score (tenth bit units)
CodRg : coding region score (tenth bit units)
P     : probability of exon (sum over all parses containing exon)
Tscr  : exon score (depends on length, I/Ac, Do/T and CodRg scores)

Comments

The SCORE of a predicted feature (e.g., exon or splice site) is a
log-odds measure of the quality of the feature based on local sequence
properties. For example, a predicted 5' splice site with
score > 100 is strong; 50-100 is moderate; 0-50 is weak; and
below 0 is poor (more than likely not a real donor site).

The PROBABILITY of a predicted exon is the estimated probability under
GENSCAN's model of genomic sequence structure that the exon is correct.
This probability depends in general on global as well as local sequence
properties, e.g., it depends on how well the exon fits with neighboring
exons.  It has been shown that predicted exons with higher probabilities
are more likely to be correct than those with lower probabilities.